Lineage for d1svtf2 (1svt F:137-190,F:367-409)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555716Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 2555717Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 2555718Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 2555719Protein GroEL, I domain [54851] (4 species)
  7. 2555720Species Escherichia coli [TaxId:562] [54852] (11 PDB entries)
  8. 2555817Domain d1svtf2: 1svt F:137-190,F:367-409 [197491]
    Other proteins in same PDB: d1svta1, d1svta3, d1svtb1, d1svtb3, d1svtc1, d1svtc3, d1svtd1, d1svtd3, d1svte1, d1svte3, d1svtf1, d1svtf3, d1svtg1, d1svtg3, d1svth1, d1svth3, d1svti1, d1svti3, d1svtj1, d1svtj3, d1svtk1, d1svtk3, d1svtl1, d1svtl3, d1svtm1, d1svtm3, d1svtn1, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_
    automated match to d1pcqa3
    complexed with adp, af3, k, mg

Details for d1svtf2

PDB Entry: 1svt (more details), 2.81 Å

PDB Description: crystal structure of groel14-groes7-(adp-alfx)7
PDB Compounds: (F:) groEL protein

SCOPe Domain Sequences for d1svtf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svtf2 d.56.1.1 (F:137-190,F:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOPe Domain Coordinates for d1svtf2:

Click to download the PDB-style file with coordinates for d1svtf2.
(The format of our PDB-style files is described here.)

Timeline for d1svtf2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1svta1, d1svta2, d1svta3, d1svtb1, d1svtb2, d1svtb3, d1svtc1, d1svtc2, d1svtc3, d1svtd1, d1svtd2, d1svtd3, d1svte1, d1svte2, d1svte3, d1svtg1, d1svtg2, d1svtg3, d1svth1, d1svth2, d1svth3, d1svti1, d1svti2, d1svti3, d1svtj1, d1svtj2, d1svtj3, d1svtk1, d1svtk2, d1svtk3, d1svtl1, d1svtl2, d1svtl3, d1svtm1, d1svtm2, d1svtm3, d1svtn1, d1svtn2, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_