| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily) 3-helical bundle packed against 3-stranded mixed beta-sheet |
Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) ![]() |
| Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein) |
| Protein GroEL, I domain [54851] (4 species) |
| Species Escherichia coli [TaxId:562] [54852] (11 PDB entries) |
| Domain d1svtf2: 1svt F:137-190,F:367-409 [197491] Other proteins in same PDB: d1svta1, d1svta3, d1svtb1, d1svtb3, d1svtc1, d1svtc3, d1svtd1, d1svtd3, d1svte1, d1svte3, d1svtf1, d1svtf3, d1svtg1, d1svtg3, d1svth1, d1svth3, d1svti1, d1svti3, d1svtj1, d1svtj3, d1svtk1, d1svtk3, d1svtl1, d1svtl3, d1svtm1, d1svtm3, d1svtn1, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_ automated match to d1pcqa3 complexed with adp, af3, k, mg |
PDB Entry: 1svt (more details), 2.81 Å
SCOPe Domain Sequences for d1svtf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svtf2 d.56.1.1 (F:137-190,F:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee
Timeline for d1svtf2:
View in 3DDomains from other chains: (mouse over for more information) d1svta1, d1svta2, d1svta3, d1svtb1, d1svtb2, d1svtb3, d1svtc1, d1svtc2, d1svtc3, d1svtd1, d1svtd2, d1svtd3, d1svte1, d1svte2, d1svte3, d1svtg1, d1svtg2, d1svtg3, d1svth1, d1svth2, d1svth3, d1svti1, d1svti2, d1svti3, d1svtj1, d1svtj2, d1svtj3, d1svtk1, d1svtk2, d1svtk3, d1svtl1, d1svtl2, d1svtl3, d1svtm1, d1svtm2, d1svtm3, d1svtn1, d1svtn2, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_ |