Lineage for d1svtb2 (1svt B:137-190,B:367-409)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2948832Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 2948833Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 2948834Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 2948835Protein GroEL, I domain [54851] (4 species)
  7. 2948836Species Escherichia coli [TaxId:562] [54852] (11 PDB entries)
  8. 2948929Domain d1svtb2: 1svt B:137-190,B:367-409 [197479]
    Other proteins in same PDB: d1svta1, d1svta3, d1svtb1, d1svtb3, d1svtc1, d1svtc3, d1svtd1, d1svtd3, d1svte1, d1svte3, d1svtf1, d1svtf3, d1svtg1, d1svtg3, d1svth1, d1svth3, d1svti1, d1svti3, d1svtj1, d1svtj3, d1svtk1, d1svtk3, d1svtl1, d1svtl3, d1svtm1, d1svtm3, d1svtn1, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_
    automated match to d1pcqa3
    complexed with adp, af3, k, mg

Details for d1svtb2

PDB Entry: 1svt (more details), 2.81 Å

PDB Description: crystal structure of groel14-groes7-(adp-alfx)7
PDB Compounds: (B:) groEL protein

SCOPe Domain Sequences for d1svtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svtb2 d.56.1.1 (B:137-190,B:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOPe Domain Coordinates for d1svtb2:

Click to download the PDB-style file with coordinates for d1svtb2.
(The format of our PDB-style files is described here.)

Timeline for d1svtb2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1svta1, d1svta2, d1svta3, d1svtc1, d1svtc2, d1svtc3, d1svtd1, d1svtd2, d1svtd3, d1svte1, d1svte2, d1svte3, d1svtf1, d1svtf2, d1svtf3, d1svtg1, d1svtg2, d1svtg3, d1svth1, d1svth2, d1svth3, d1svti1, d1svti2, d1svti3, d1svtj1, d1svtj2, d1svtj3, d1svtk1, d1svtk2, d1svtk3, d1svtl1, d1svtl2, d1svtl3, d1svtm1, d1svtm2, d1svtm3, d1svtn1, d1svtn2, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_