SCOPe 2.08: Domain d1svtb1: 1svt B:2-136,B:410-525

Lineage for d1svtb1 (1svt B:2-136,B:410-525)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
   multihelical; 8 helices arranged in 2 parallel layers

4. Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families)
   duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site

5. Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)

6. Protein GroEL, E domain [48594] (4 species)

7. Species Escherichia coli [TaxId:562] [48595] (11 PDB entries)

8. Domain d1svtb1: 1svt B:2-136,B:410-525 [197478]
   Other proteins in same PDB: d1svta2, d1svta3, d1svtb2, d1svtb3, d1svtc2, d1svtc3, d1svtd2, d1svtd3, d1svte2, d1svte3, d1svtf2, d1svtf3, d1svtg2, d1svtg3, d1svth2, d1svth3, d1svti2, d1svti3, d1svtj2, d1svtj3, d1svtk2, d1svtk3, d1svtl2, d1svtl3, d1svtm2, d1svtm3, d1svtn2, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_
   automated match to d1pcqa1
   complexed with adp, af3, k, mg

Details for d1svtb1

PDB Entry: 1svt, 2.81 Å

PDB Description: crystal structure of groel14-groes7-(adp-alfx)7

PDB Compounds: (B:) groEL protein

SCOPe Domain Sequences for d1svtb1:

Sequence; same for both SEQRES and ATOM records:

>d1svtb1 a.129.1.1 (B:2-136,B:410-525) GroEL, E domain {Escherichia coli [TaxId: 562]}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

Timeline for d1svtb1:

• d1svtb1 first appeared in SCOPe 2.03
  
• d1svtb1 appears in SCOPe 2.07