Lineage for d1svta3 (1svt A:191-366)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583187Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1583357Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 1583358Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 1583359Protein GroEL, A domain [52031] (4 species)
  7. 1583360Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)
  8. 1583463Domain d1svta3: 1svt A:191-366 [197477]
    Other proteins in same PDB: d1svta1, d1svta2, d1svtb1, d1svtb2, d1svtc1, d1svtc2, d1svtd1, d1svtd2, d1svte1, d1svte2, d1svtf1, d1svtf2, d1svtg1, d1svtg2, d1svth1, d1svth2, d1svti1, d1svti2, d1svtj1, d1svtj2, d1svtk1, d1svtk2, d1svtl1, d1svtl2, d1svtm1, d1svtm2, d1svtn1, d1svtn2, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_
    automated match to d1pcqa2
    complexed with adp, af3, k, mg

Details for d1svta3

PDB Entry: 1svt (more details), 2.81 Å

PDB Description: crystal structure of groel14-groes7-(adp-alfx)7
PDB Compounds: (A:) groEL protein

SCOPe Domain Sequences for d1svta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svta3 c.8.5.1 (A:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOPe Domain Coordinates for d1svta3:

Click to download the PDB-style file with coordinates for d1svta3.
(The format of our PDB-style files is described here.)

Timeline for d1svta3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1svtb1, d1svtb2, d1svtb3, d1svtc1, d1svtc2, d1svtc3, d1svtd1, d1svtd2, d1svtd3, d1svte1, d1svte2, d1svte3, d1svtf1, d1svtf2, d1svtf3, d1svtg1, d1svtg2, d1svtg3, d1svth1, d1svth2, d1svth3, d1svti1, d1svti2, d1svti3, d1svtj1, d1svtj2, d1svtj3, d1svtk1, d1svtk2, d1svtk3, d1svtl1, d1svtl2, d1svtl3, d1svtm1, d1svtm2, d1svtm3, d1svtn1, d1svtn2, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_