SCOPe 2.08: Domain d1cdcb_: 1cdc B:

Lineage for d1cdcb_ (1cdc B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD2, first domain [48740] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries)

8. Domain d1cdcb_: 1cdc B: [19747]
   misfolded V (N-terminal) domain dimer

Details for d1cdcb_

PDB Entry: 1cdc, 2 Å

PDB Description: cd2, n-terminal domain (1-99), truncated form

PDB Compounds: (B:) cd2

SCOPe Domain Sequences for d1cdcb_:

Sequence; same for both SEQRES and ATOM records:

>d1cdcb_ b.1.1.1 (B:) CD2, first domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilangdl
kiknltrddsgtynvtvystngtrildkaldlrile

Timeline for d1cdcb_:

• d1cdcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cdcb_ appears in SCOPe 2.07