SCOPe 2.07: Domain d1oyvi2: 1oyv I:1-15,I:86-116

Lineage for d1oyvi2 (1oyv I:1-15,I:86-116)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily)
   disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III

4. Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family)

5. Family g.69.1.1: Plant proteinase inhibitors [57486] (4 proteins)

6. Protein Wound-induced proteinase inhibitor-II [90168] (1 species)
   two-domain inhibitor; consists of one continuous domain of canonical fold and one discontinuous, circularly-permutated domain

7. Species Tomato (Lycopersicon esculentum) [TaxId:4081] [90169] (2 PDB entries)

8. Domain d1oyvi2: 1oyv I:1-15,I:86-116 [197464]
   Other proteins in same PDB: d1oyva_, d1oyvb_
   complexed with ca

Details for d1oyvi2

PDB Entry: 1oyv, 2.5 Å

PDB Description: crystal structure of tomato inhibitor-ii in a ternary complex with subtilisin carlsberg

PDB Compounds: (I:) Wound-induced proteinase inhibitor-II

SCOPe Domain Sequences for d1oyvi2:

Sequence; same for both SEQRES and ATOM records:

>d1oyvi2 g.69.1.1 (I:1-15,I:86-116) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum) [TaxId: 4081]}
kactrecgnlgfgicXgcttcctgykgcyyfgkdgkfvcegesdepk

Timeline for d1oyvi2:

• d1oyvi2 first appeared in SCOPe 2.03
  
• d1oyvi2 appears in SCOPe 2.06
  
• d1oyvi2 appears in the current release, SCOPe 2.08