Lineage for d1oyvi2 (1oyv I:1-15,I:86-116)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2265009Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily)
    disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III
  4. 2265010Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family) (S)
  5. 2265011Family g.69.1.1: Plant proteinase inhibitors [57486] (4 proteins)
  6. 2265022Protein Wound-induced proteinase inhibitor-II [90168] (1 species)
    two-domain inhibitor; consists of one continuous domain of canonical fold and one discontinuous, circularly-permutated domain
  7. 2265023Species Tomato (Lycopersicon esculentum) [TaxId:4081] [90169] (2 PDB entries)
  8. 2265033Domain d1oyvi2: 1oyv I:1-15,I:86-116 [197464]
    Other proteins in same PDB: d1oyva_, d1oyvb_
    complexed with ca

Details for d1oyvi2

PDB Entry: 1oyv (more details), 2.5 Å

PDB Description: crystal structure of tomato inhibitor-ii in a ternary complex with subtilisin carlsberg
PDB Compounds: (I:) Wound-induced proteinase inhibitor-II

SCOPe Domain Sequences for d1oyvi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyvi2 g.69.1.1 (I:1-15,I:86-116) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum) [TaxId: 4081]}
kactrecgnlgfgicXgcttcctgykgcyyfgkdgkfvcegesdepk

SCOPe Domain Coordinates for d1oyvi2:

Click to download the PDB-style file with coordinates for d1oyvi2.
(The format of our PDB-style files is described here.)

Timeline for d1oyvi2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oyvi1