Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins) N-terminal all-beta domain defines family |
Protein Hypothetical protein YhdH [102126] (1 species) |
Species Escherichia coli [TaxId:562] [102127] (2 PDB entries) Uniprot P26646 |
Domain d1o8cd4: 1o8c D:116-292 [197462] Other proteins in same PDB: d1o8ca3, d1o8ca5, d1o8cb3, d1o8cb5, d1o8cc1, d1o8cd3, d1o8cd5 Structural genomics target complexed with ndp |
PDB Entry: 1o8c (more details), 2.6 Å
SCOPe Domain Sequences for d1o8cd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o8cd4 c.2.1.1 (D:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} ldarkamiigtagftamlcvmaledagvrpqdgeivvtgasggvgstavallhklgyqvv avsgrestheylkslgasrvlprdefaesrplekqvwagaidtvgdkvlakvlaqmnygg cvaacglaggftlpttvmpfilrnvrlqgvdsvmtpperraqawqrlvadlpesfyt
Timeline for d1o8cd4: