SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1o8cd4 (1o8c D:116-292)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090220Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 protein domains)
    N-terminal all-beta domain defines family
  6. 2090485Protein Hypothetical protein YhdH [102126] (1 species)
  7. 2090486Species Escherichia coli [TaxId:562] [102127] (2 PDB entries)
    Uniprot P26646
  8. 2090491Domain d1o8cd4: 1o8c D:116-292 [197462]
    Other proteins in same PDB: d1o8ca3, d1o8ca5, d1o8cb3, d1o8cb5, d1o8cc1, d1o8cd3, d1o8cd5
    Structural genomics target
    complexed with ndp

Details for d1o8cd4

PDB Entry: 1o8c (more details), 2.6 Å

PDB Description: crystal structure of e. coli k-12 yhdh with bound nadph
PDB Compounds: (D:) yhdh

SCOPe Domain Sequences for d1o8cd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8cd4 c.2.1.1 (D:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]}
ldarkamiigtagftamlcvmaledagvrpqdgeivvtgasggvgstavallhklgyqvv
avsgrestheylkslgasrvlprdefaesrplekqvwagaidtvgdkvlakvlaqmnygg
cvaacglaggftlpttvmpfilrnvrlqgvdsvmtpperraqawqrlvadlpesfyt

SCOPe Domain Coordinates for d1o8cd4:

Click to download the PDB-style file with coordinates for d1o8cd4.
(The format of our PDB-style files is described here.)

Timeline for d1o8cd4: