SCOPe 2.06: Domain d1o8cc3: 1o8c C:116-292

Lineage for d1o8cc3 (1o8c C:116-292)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
   N-terminal all-beta domain defines family

6. Protein Hypothetical protein YhdH [102126] (1 species)

7. Species Escherichia coli [TaxId:562] [102127] (2 PDB entries)
   Uniprot P26646

8. Domain d1o8cc3: 1o8c C:116-292 [197461]
   Other proteins in same PDB: d1o8ca3, d1o8ca5, d1o8cb3, d1o8cb5, d1o8cc1, d1o8cd3, d1o8cd5
   Structural genomics target
   complexed with ndp

Details for d1o8cc3

PDB Entry: 1o8c, 2.6 Å

PDB Description: crystal structure of e. coli k-12 yhdh with bound nadph

PDB Compounds: (C:) yhdh

SCOPe Domain Sequences for d1o8cc3:

Sequence; same for both SEQRES and ATOM records:

>d1o8cc3 c.2.1.1 (C:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]}
ldarkamiigtagftamlcvmaledagvrpqdgeivvtgasggvgstavallhklgyqvv
avsgrestheylkslgasrvlprdefaesrplekqvwagaidtvgdkvlakvlaqmnygg
cvaacglaggftlpttvmpfilrnvrlqgvdsvmtpperraqawqrlvadlpesfyt

Timeline for d1o8cc3:

• d1o8cc3 first appeared in SCOPe 2.03
  
• d1o8cc3 appears in SCOPe 2.05
  
• d1o8cc3 appears in SCOPe 2.07
  
• d1o8cc3 appears in the current release, SCOPe 2.08