Lineage for d1do8b4 (1do8 B:1021-1279)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890498Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
    Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
  6. 2890505Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)
  7. 2890523Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)
  8. 2890543Domain d1do8b4: 1do8 B:1021-1279 [197454]
    Other proteins in same PDB: d1do8a1, d1do8b3, d1do8c3, d1do8d3
    complexed with mn, nad, oxl

Details for d1do8b4

PDB Entry: 1do8 (more details), 2.2 Å

PDB Description: crystal structure of a closed form of human mitochondrial nad(p)+- dependent malic enzyme
PDB Compounds: (B:) malic enzyme

SCOPe Domain Sequences for d1do8b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1do8b4 c.58.1.3 (B:1021-1279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd

SCOPe Domain Coordinates for d1do8b4:

Click to download the PDB-style file with coordinates for d1do8b4.
(The format of our PDB-style files is described here.)

Timeline for d1do8b4: