Lineage for d3zlma_ (3zlm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738537Fold a.265: Fic-like [140930] (1 superfamily)
    multihelical; one central helix is surrounded by seven helices
  4. 2738538Superfamily a.265.1: Fic-like [140931] (1 family) (S)
  5. 2738539Family a.265.1.1: Fic-like [140932] (3 proteins)
    Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix
  6. 2738547Protein automated matches [191277] (4 species)
    not a true protein
  7. 2738583Species Neisseria meningitidis [TaxId:487] [197451] (1 PDB entry)
  8. 2738584Domain d3zlma_: 3zlm A: [197452]
    automated match to d3s6aa_
    complexed with anp, mg; mutant

Details for d3zlma_

PDB Entry: 3zlm (more details), 2 Å

PDB Description: Fic protein from Neisseria meningitidis mutant E186G in complex with AMPPNP
PDB Compounds: (A:) adenosine monophosphate-protein transferase nmfic

SCOPe Domain Sequences for d3zlma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zlma_ a.265.1.1 (A:) automated matches {Neisseria meningitidis [TaxId: 487]}
sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
vnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqsyyyggye

SCOPe Domain Coordinates for d3zlma_:

Click to download the PDB-style file with coordinates for d3zlma_.
(The format of our PDB-style files is described here.)

Timeline for d3zlma_: