| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.265: Fic-like [140930] (1 superfamily) multihelical; one central helix is surrounded by seven helices |
Superfamily a.265.1: Fic-like [140931] (1 family) ![]() |
| Family a.265.1.1: Fic-like [140932] (3 proteins) Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix |
| Protein automated matches [191277] (4 species) not a true protein |
| Species Neisseria meningitidis [TaxId:487] [197451] (1 PDB entry) |
| Domain d3zlma_: 3zlm A: [197452] automated match to d3s6aa_ complexed with anp, mg; mutant |
PDB Entry: 3zlm (more details), 2 Å
SCOPe Domain Sequences for d3zlma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zlma_ a.265.1.1 (A:) automated matches {Neisseria meningitidis [TaxId: 487]}
sideqslhnarrlfesgdidrievgttaglqqihrylfgglydfagqiredniskggfrf
anamylkealvkieqmpertfeeiiakyvemniahpflegngrstriwldlvlkknlkkv
vnwqnvsktlylqamerspvndlelrfllkdnltddvdnreiifkgieqsyyyggye
Timeline for d3zlma_: