Lineage for d2yg1a_ (2yg1 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781267Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 1781325Protein automated matches [190170] (12 species)
    not a true protein
  7. 1781338Species Heterobasidion annosum [TaxId:13563] [189755] (2 PDB entries)
  8. 1781340Domain d2yg1a_: 2yg1 A: [197450]
    automated match to d2xspa_
    complexed with mg

Details for d2yg1a_

PDB Entry: 2yg1 (more details), 1.9 Å

PDB Description: apo structure of cellobiohydrolase 1 (cel7a) from heterobasidion annosum
PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d2yg1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yg1a_ b.29.1.10 (A:) automated matches {Heterobasidion annosum [TaxId: 13563]}
eqvgtqtaenhpkltvsqcsaggscttesrsvvldsnwrwlhttsgttncytgntwdasl
cpdpvtcaqncaldgadysgtygistsgnaltlkfvtngpystnigsrvylmsaddtnye
ifklknqefafdvdmsnlpcglngalyfvemdadgglsrfpnnkagskygtgycdtqcpq
dikfingeanilgwtpsssdsnagtgqygsccnemdvweaninsaavtphvcnvqgqtrc
sgtqcgdgderydgicdkdgcdfnsfrmgnqtflgpgktvntnskftvvtqfltsdnttt
gtlheirrlyvqngkviansktniagmsqfdsitddfcnaqktafgdtnsfenlgglnvm
gqafdkgvvlvmsvwddheanmlwldsdypttssastpgvargtcattsgvpanvesqnp
nssvvfsnikigpigstyta

SCOPe Domain Coordinates for d2yg1a_:

Click to download the PDB-style file with coordinates for d2yg1a_.
(The format of our PDB-style files is described here.)

Timeline for d2yg1a_: