Lineage for d1gya__ (1gya -)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein CD2, first domain [48740] (2 species) Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries) 
Domain d1gya__: 1gya - [19745]
Details for d1gya__
PDB Entry: 1gya (more details)
PDB Description: n-glycan and polypeptide nmr solution structures of the adhesion domain of human cd2
SCOP Domain Sequences for d1gya__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gya__ b.1.1.1 (-) CD2, first domain {Human (Homo sapiens)}
keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer
SCOP Domain Coordinates for d1gya__:
Click to download the PDB-style file with coordinates for d1gya__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gya__:
- d1gya__ first appeared (with stable ids) in SCOP 1.55
- d1gya__ appears in SCOP 1.59
- d1gya__ appears in SCOP 1.63
- d1gya__ appears in the current release, SCOPe 2.08, called d1gyaa_
View in 3D