Lineage for d1gya__ (1gya -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101940Protein CD2, first domain [48740] (2 species)
  7. 101941Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)
  8. 101946Domain d1gya__: 1gya - [19745]

Details for d1gya__

PDB Entry: 1gya (more details)

PDB Description: n-glycan and polypeptide nmr solution structures of the adhesion domain of human cd2
PDB Compounds: ( :)

SCOP Domain Sequences for d1gya__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gya__ b.1.1.1 (-) CD2, first domain {Human (Homo sapiens)}
keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer

SCOP Domain Coordinates for d1gya__:

Click to download the PDB-style file with coordinates for d1gya__.
(The format of our PDB-style files is described here.)

Timeline for d1gya__: