SCOPe 2.07: Domain d3v3xb1: 3v3x B:3-56

Lineage for d3v3xb1 (3v3x B:3-56)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)

7. Species Streptococcus sp. [TaxId:1320] [193546] (12 PDB entries)

8. Domain d3v3xb1: 3v3x B:3-56 [197445]
   Other proteins in same PDB: d3v3xa2, d3v3xb2, d3v3xc2, d3v3xd2
   automated match to d3v3xc_
   complexed with 2pe, act, gol, mtn; mutant

Details for d3v3xb1

PDB Entry: 3v3x, 2 Å

PDB Description: Nitroxide Spin Labels in Protein GB1: N8/K28 Double Mutant

PDB Compounds: (B:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d3v3xb1:

Sequence; same for both SEQRES and ATOM records:

>d3v3xb1 d.15.7.1 (B:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
yklilcgktlkgettteavdaataecvfkqyandngvdgewtyddatktftvte

Timeline for d3v3xb1:

• d3v3xb1 first appeared in SCOPe 2.02, called d3v3xb_
  
• d3v3xb1 appears in SCOPe 2.06
  
• d3v3xb1 appears in the current release, SCOPe 2.08