Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species) |
Species Streptococcus sp. [TaxId:1320] [193546] (1 PDB entry) |
Domain d3v3xb_: 3v3x B: [197445] automated match to d3v3xc_ complexed with 2pe, act, gol, mtn; mutant |
PDB Entry: 3v3x (more details), 2 Å
SCOPe Domain Sequences for d3v3xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v3xb_ d.15.7.1 (B:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]} mqyklilcgktlkgettteavdaataecvfkqyandngvdgewtyddatktftvte
Timeline for d3v3xb_: