Lineage for d3stxb_ (3stx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136389Species Lycopersicon hirsutum [TaxId:283673] [195413] (6 PDB entries)
  8. 2136401Domain d3stxb_: 3stx B: [197444]
    automated match to d3gzja_
    complexed with bka

Details for d3stxb_

PDB Entry: 3stx (more details), 2.3 Å

PDB Description: Crystal Structure of tomato Methylketone Synthase I H243A variant complexed with beta-ketoheptanoate
PDB Compounds: (B:) Methylketone synthase 1

SCOPe Domain Sequences for d3stxb_:

Sequence, based on SEQRES records: (download)

>d3stxb_ c.69.1.0 (B:) automated matches {Lycopersicon hirsutum [TaxId: 283673]}
spfvkkhfvlvhtafhgawcwykivalmrssghnvtaldlgasginpkqalqipnfsdyl
splmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpnidattvc
tkagsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalatalvrplyl
ylaediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkeiegsdavt
mmskpqqlfttllsiankyk

Sequence, based on observed residues (ATOM records): (download)

>d3stxb_ c.69.1.0 (B:) automated matches {Lycopersicon hirsutum [TaxId: 283673]}
spfvkkhfvlvhtafhgawcwykivalmrssghnvtaldlgasginpkqalqipnfsdyl
splmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpnidattvc
tkagsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalatalvrplyl
ylaediskevvlsskrygsvkrvfivatenkkeflklmieknppdevkeiegsdavtmms
kpqqlfttllsiankyk

SCOPe Domain Coordinates for d3stxb_:

Click to download the PDB-style file with coordinates for d3stxb_.
(The format of our PDB-style files is described here.)

Timeline for d3stxb_: