SCOPe 2.02: Domain d3r0ea_: 3r0e A:

Lineage for d3r0ea_ (3r0e A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)
   consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
   duplication: consists of two domains of this fold

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families)

5. Family b.78.1.0: automated matches [191418] (1 protein)
   not a true family

6. Protein automated matches [190587] (4 species)
   not a true protein

7. Species Remusatia vivipara [TaxId:189456] [193663] (1 PDB entry)

8. Domain d3r0ea_: 3r0e A: [197432]
   automated match to d3r0ed_

Details for d3r0ea_

PDB Entry: 3r0e, 2.4 Å

PDB Description: Structure of Remusatia vivipara lectin

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d3r0ea_:

Sequence; same for both SEQRES and ATOM records:

>d3r0ea_ b.78.1.0 (A:) automated matches {Remusatia vivipara [TaxId: 189456]}
lgtnyllsgqtldteghlkngdfdlvmqddcnlvlyngnwqsntanngrdckltltdyge
lvikngdgstvwksgaqsvkgnyaavvhpdgrlvvfgpsvfkidpwvrg

Timeline for d3r0ea_:

• d3r0ea_ is new in SCOPe 2.02-stable
  
• d3r0ea_ appears in SCOPe 2.03
  
• d3r0ea_ appears in the current release, SCOPe 2.08