![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein CD2, first domain [48740] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries) |
![]() | Domain d1qa9c_: 1qa9 C: [19743] Other proteins in same PDB: d1qa9b_, d1qa9d_ |
PDB Entry: 1qa9 (more details), 3.2 Å
SCOPe Domain Sequences for d1qa9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qa9c_ b.1.1.1 (C:) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyell kngalkikhlktddqdiykvsiydtkgknvlekifdlkiqer
Timeline for d1qa9c_: