SCOP 1.61: Domain d1qa9c_: 1qa9 C:

Lineage for d1qa9c_ (1qa9 C:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein CD2, first domain [48740] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)

8. Domain d1qa9c_: 1qa9 C: [19743]
   Other proteins in same PDB: d1qa9b_, d1qa9d_

Details for d1qa9c_

PDB Entry: 1qa9, 3.2 Å

PDB Description: Structure of a Heterophilic Adhesion Complex Between the Human CD2 and CD58(LFA-3) Counter-Receptors

SCOP Domain Sequences for d1qa9c_:

Sequence; same for both SEQRES and ATOM records:

>d1qa9c_ b.1.1.1 (C:) CD2, first domain {Human (Homo sapiens)}
tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyell
kngalkikhlktddqdiykvsiydtkgknvlekifdlkiqer

Timeline for d1qa9c_:

• d1qa9c_ first appeared (with stable ids) in SCOP 1.55
  
• d1qa9c_ appears in SCOP 1.59
  
• d1qa9c_ appears in SCOP 1.63
  
• d1qa9c_ appears in the current release, SCOPe 2.08