Lineage for d1qa9c_ (1qa9 C:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101940Protein CD2, first domain [48740] (2 species)
  7. 101941Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)
  8. 101944Domain d1qa9c_: 1qa9 C: [19743]
    Other proteins in same PDB: d1qa9b_, d1qa9d_

Details for d1qa9c_

PDB Entry: 1qa9 (more details), 3.2 Å

PDB Description: Structure of a Heterophilic Adhesion Complex Between the Human CD2 and CD58(LFA-3) Counter-Receptors
PDB Compounds: (C:)

SCOP Domain Sequences for d1qa9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qa9c_ b.1.1.1 (C:) CD2, first domain {Human (Homo sapiens)}
tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyell
kngalkikhlktddqdiykvsiydtkgknvlekifdlkiqer

SCOP Domain Coordinates for d1qa9c_:

Click to download the PDB-style file with coordinates for d1qa9c_.
(The format of our PDB-style files is described here.)

Timeline for d1qa9c_: