Lineage for d1qa9c_ (1qa9 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2017180Protein CD2, first domain [48740] (2 species)
  7. 2017181Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)
  8. 2017184Domain d1qa9c_: 1qa9 C: [19743]
    Other proteins in same PDB: d1qa9b_, d1qa9d_

Details for d1qa9c_

PDB Entry: 1qa9 (more details), 3.2 Å

PDB Description: Structure of a Heterophilic Adhesion Complex Between the Human CD2 and CD58(LFA-3) Counter-Receptors
PDB Compounds: (C:) human cd2 protein

SCOPe Domain Sequences for d1qa9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qa9c_ b.1.1.1 (C:) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]}
tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyell
kngalkikhlktddqdiykvsiydtkgknvlekifdlkiqer

SCOPe Domain Coordinates for d1qa9c_:

Click to download the PDB-style file with coordinates for d1qa9c_.
(The format of our PDB-style files is described here.)

Timeline for d1qa9c_: