Lineage for d1qa9a_ (1qa9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739582Protein CD2, first domain [48740] (2 species)
  7. 2739583Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)
  8. 2739585Domain d1qa9a_: 1qa9 A: [19742]
    Other proteins in same PDB: d1qa9b_, d1qa9d_

Details for d1qa9a_

PDB Entry: 1qa9 (more details), 3.2 Å

PDB Description: Structure of a Heterophilic Adhesion Complex Between the Human CD2 and CD58(LFA-3) Counter-Receptors
PDB Compounds: (A:) human cd2 protein

SCOPe Domain Sequences for d1qa9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qa9a_ b.1.1.1 (A:) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]}
tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyell
kngalkikhlktddqdiykvsiydtkgknvlekifdlkiqer

SCOPe Domain Coordinates for d1qa9a_:

Click to download the PDB-style file with coordinates for d1qa9a_.
(The format of our PDB-style files is described here.)

Timeline for d1qa9a_: