![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
![]() | Protein automated matches [190209] (5 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11698] [195546] (3 PDB entries) |
![]() | Domain d4jlha_: 4jlh A: [197409] automated match to d1bl3c_ complexed with 0l9, so4; mutant |
PDB Entry: 4jlh (more details), 2.09 Å
SCOPe Domain Sequences for d4jlha_:
Sequence, based on SEQRES records: (download)
>d4jlha_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]} cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvktacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta vqmavfihnkkrkggiggysagerivdiiatdiq
>d4jlha_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]} cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvktacwwagikqefesmnkelkkiigqvrdqaehlktavqmavfihnkkr kgggysagerivdiiatdiq
Timeline for d4jlha_: