Lineage for d4jlha_ (4jlh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124026Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 protein domains)
  6. 2124148Protein automated matches [190209] (5 species)
    not a true protein
  7. 2124269Species Human immunodeficiency virus type 1 [TaxId:11698] [195546] (3 PDB entries)
  8. 2124271Domain d4jlha_: 4jlh A: [197409]
    automated match to d1bl3c_
    complexed with 0l9, so4; mutant

Details for d4jlha_

PDB Entry: 4jlh (more details), 2.09 Å

PDB Description: hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor
PDB Compounds: (A:) HIV-1 Integrase catalytic core domain

SCOPe Domain Sequences for d4jlha_:

Sequence, based on SEQRES records: (download)

>d4jlha_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvktacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d4jlha_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvktacwwagikqefesmnkelkkiigqvrdqaehlktavqmavfihnkkr
kgggysagerivdiiatdiq

SCOPe Domain Coordinates for d4jlha_:

Click to download the PDB-style file with coordinates for d4jlha_.
(The format of our PDB-style files is described here.)

Timeline for d4jlha_: