SCOPe 2.08: Domain d4jlha_: 4jlh A:

Lineage for d4jlha_ (4jlh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
   Pfam PF00665

6. Protein automated matches [190209] (5 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11698] [195546] (3 PDB entries)

8. Domain d4jlha_: 4jlh A: [197409]
   automated match to d1bl3c_
   complexed with 0l9, so4; mutant

Details for d4jlha_

PDB Entry: 4jlh, 2.09 Å

PDB Description: hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor

PDB Compounds: (A:) HIV-1 Integrase catalytic core domain

SCOPe Domain Sequences for d4jlha_:

Sequence, based on SEQRES records:

>d4jlha_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvktacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d4jlha_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvktacwwagikqefesmnkelkkiigqvrdqaehlktavqmavfihnkkr
kgggysagerivdiiatdiq

Timeline for d4jlha_:

• d4jlha_ first appeared in SCOPe 2.02
  
• d4jlha_ appears in SCOPe 2.07