Lineage for d4in0b_ (4in0 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854913Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries)
  8. 1854916Domain d4in0b_: 4in0 B: [197405]
    automated match to d3gixa_
    complexed with suc

Details for d4in0b_

PDB Entry: 4in0 (more details), 1.33 Å

PDB Description: crystal structure of human splicing factor dim2/txnl4b
PDB Compounds: (B:) Thioredoxin-like protein 4B

SCOPe Domain Sequences for d4in0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4in0b_ c.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfllpkltskkevdqaikstaekvlvlrfgrdedpvclqlddilsktssdlskmaaiylv
dvdqtavytqyfdisyipstvfffngqhmkvdygspdhtkfvgsfktkqdfidlieviyr
gamrgklivqspidpknipky

SCOPe Domain Coordinates for d4in0b_:

Click to download the PDB-style file with coordinates for d4in0b_.
(The format of our PDB-style files is described here.)

Timeline for d4in0b_: