Lineage for d4iawa1 (4iaw A:1-178)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2413962Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 2413963Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)
  8. 2414051Domain d4iawa1: 4iaw A:1-178 [197402]
    Other proteins in same PDB: d4iawa2
    automated match to d3dtqc_
    complexed with liz, yt3

Details for d4iawa1

PDB Entry: 4iaw (more details), 2.4 Å

PDB Description: Engineered human lipocalin 2 (C26) in complex with Y-DTPA
PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d4iawa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iawa1 b.60.1.1 (A:1-178) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
qdstsdlipapplskvplqqnfqdnqfhgkwyqvgragnaapredkdllkmtaqtyelke
dksynvtavrfrkkmceyltmtfvpgsqpgeftlgniksypgltsylvrvvstnynqham
vffkkvqqnreyfsisllgrtkelaselkenfirfskslglpenhivfpvpidqcidg

SCOPe Domain Coordinates for d4iawa1:

Click to download the PDB-style file with coordinates for d4iawa1.
(The format of our PDB-style files is described here.)

Timeline for d4iawa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4iawa2