SCOPe 2.02: Domain d4iaxa_: 4iax A:

Lineage for d4iaxa_ (4iax A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (17 PDB entries)

8. Domain d4iaxa_: 4iax A: [197401]
   automated match to d3dtqc_
   complexed with liz, yt3

Details for d4iaxa_

PDB Entry: 4iax, 1.9 Å

PDB Description: Engineered human lipocalin 2 (CL31) in complex with Y-DTPA

PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d4iaxa_:

Sequence; same for both SEQRES and ATOM records:

>d4iaxa_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
dlipapplskvplqqnfqdnqfhgkwyqvgragnaappmdpelllltaqtyelkedksyd
vtavrfrkkmceyltmtfvpspqpgeftlgniknypgltsyfvrvvstnynqhamvffkk
vqqnreyfsisllgrtkelaselkenfirfskslglpenhivfpvpidqcid

Timeline for d4iaxa_:

• d4iaxa_ is new in SCOPe 2.02-stable
  
• d4iaxa_ appears in SCOPe 2.03
  
• d4iaxa_ appears in the current release, SCOPe 2.08