Lineage for d4iaxa_ (4iax A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395398Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2395571Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 2395572Species Human (Homo sapiens) [TaxId:9606] [50836] (44 PDB entries)
  8. 2395573Domain d4iaxa_: 4iax A: [197401]
    automated match to d3dtqc_
    complexed with liz, yt3

Details for d4iaxa_

PDB Entry: 4iax (more details), 1.9 Å

PDB Description: Engineered human lipocalin 2 (CL31) in complex with Y-DTPA
PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d4iaxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iaxa_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
dlipapplskvplqqnfqdnqfhgkwyqvgragnaappmdpelllltaqtyelkedksyd
vtavrfrkkmceyltmtfvpspqpgeftlgniknypgltsyfvrvvstnynqhamvffkk
vqqnreyfsisllgrtkelaselkenfirfskslglpenhivfpvpidqcid

SCOPe Domain Coordinates for d4iaxa_:

Click to download the PDB-style file with coordinates for d4iaxa_.
(The format of our PDB-style files is described here.)

Timeline for d4iaxa_: