Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) |
Protein CD4 V-set domains [48737] (2 species) |
Species Rat (Rattus rattus) [TaxId:10117] [48739] (1 PDB entry) |
Domain d1cid_1: 1cid 1-105 [19740] Other proteins in same PDB: d1cid_2 domain 3 complexed with so4 |
PDB Entry: 1cid (more details), 2.8 Å
SCOP Domain Sequences for d1cid_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cid_1 b.1.1.1 (1-105) CD4 V-set domains {Rat (Rattus rattus)} tsitayksegesaefsfplnlgeeslqgelrwkaekapssqswitfslknqkvsvqksts npkfqlsetlpltlqipqvslqfagsgnltltldrgilyqevnlv
Timeline for d1cid_1: