Lineage for d1cid_1 (1cid 1-105)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546488Protein CD4 V-set domains [48737] (2 species)
  7. 546514Species Rat (Rattus rattus) [TaxId:10117] [48739] (1 PDB entry)
  8. 546515Domain d1cid_1: 1cid 1-105 [19740]
    Other proteins in same PDB: d1cid_2
    domain 3
    complexed with so4

Details for d1cid_1

PDB Entry: 1cid (more details), 2.8 Å

PDB Description: crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains

SCOP Domain Sequences for d1cid_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cid_1 b.1.1.1 (1-105) CD4 V-set domains {Rat (Rattus rattus)}
tsitayksegesaefsfplnlgeeslqgelrwkaekapssqswitfslknqkvsvqksts
npkfqlsetlpltlqipqvslqfagsgnltltldrgilyqevnlv

SCOP Domain Coordinates for d1cid_1:

Click to download the PDB-style file with coordinates for d1cid_1.
(The format of our PDB-style files is described here.)

Timeline for d1cid_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cid_2