Class b: All beta proteins [48724] (176 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein automated matches [190295] (6 species) not a true protein |
Species Eel (Anguilla japonica) [TaxId:7937] [197394] (3 PDB entries) |
Domain d4i3ca_: 4i3c A: [197396] automated match to d1fdqa_ complexed with bla; mutant |
PDB Entry: 4i3c (more details), 2 Å
SCOPe Domain Sequences for d4i3ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i3ca_ b.60.1.2 (A:) automated matches {Eel (Anguilla japonica) [TaxId: 7937]} mvekfvgtwkiadshnfgeylkaigapkelsdggdattptlyisqkdgdkmtvkieqgpp tfldtqvkfklgeefdefpsdrrkgvksvvnlvgeklvyvqkwdgkettyvreikdgklv vtltmgdvvavrsyrrate
Timeline for d4i3ca_: