Lineage for d4hzma_ (4hzm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084171Species Salmonella enterica [TaxId:99287] [194211] (5 PDB entries)
  8. 2084178Domain d4hzma_: 4hzm A: [197392]
    automated match to d2oxna_
    complexed with 1bw, mes

Details for d4hzma_

PDB Entry: 4hzm (more details), 1.45 Å

PDB Description: Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide
PDB Compounds: (A:) Beta-hexosaminidase

SCOPe Domain Sequences for d4hzma_:

Sequence, based on SEQRES records: (download)

>d4hzma_ c.1.8.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
fdgvifsddlsmegaaimgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaerv
trlyhkgsfsrrelmdsarwktasaqlnqlherwqeekag

Sequence, based on observed residues (ATOM records): (download)

>d4hzma_ c.1.8.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavthketpcdp
rpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelgfdg
vifsddlsmgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaervtrlyhkgsf
srrelmdsarwktasaqlnqlherwqeekag

SCOPe Domain Coordinates for d4hzma_:

Click to download the PDB-style file with coordinates for d4hzma_.
(The format of our PDB-style files is described here.)

Timeline for d4hzma_: