SCOPe 2.07: Domain d4hrqa_: 4hrq A:

Lineage for d4hrqa_ (4hrq A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 protein domains)
   strand 5 is parallel to strand 4

6. Protein Putative deaminase NE0047 [142833] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [142834] (9 PDB entries)
   Uniprot Q82Y41 1-189

8. Domain d4hrqa_: 4hrq A: [197390]
   automated match to d2g84a1
   complexed with azg, zn

Details for d4hrqa_

PDB Entry: 4hrq, 1.9 Å

PDB Description: identification of function and mechanistic insights of guanine deaminase from nitrosomonas europaea: role of the c-terminal loop in catalysis

PDB Compounds: (A:) Cytidine and deoxycytidylate deaminase zinc-binding region

SCOPe Domain Sequences for d4hrqa_:

Sequence; same for both SEQRES and ATOM records:

>d4hrqa_ c.97.1.2 (A:) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgll
iaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgavi
wsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynac
ngviynarc

Timeline for d4hrqa_:

• d4hrqa_ first appeared in SCOPe 2.02
  
• d4hrqa_ appears in SCOPe 2.06