Lineage for d4gfma_ (4gfm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 2985292Domain d4gfma_: 4gfm A: [197385]
    automated match to d3q32b_
    complexed with 0x2

Details for d4gfma_

PDB Entry: 4gfm (more details), 2.3 Å

PDB Description: jak2 kinase (jh1 domain) with 2,6-dichloro-n-(2-oxo-2,5-dihydropyridin-4-yl)benzamide
PDB Compounds: (A:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d4gfma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gfma_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdferei
eilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsq
ickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespif
wyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhli
ellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnm

SCOPe Domain Coordinates for d4gfma_:

Click to download the PDB-style file with coordinates for d4gfma_.
(The format of our PDB-style files is described here.)

Timeline for d4gfma_: