SCOPe 2.05: Domain d4fvba_: 4fvb A:

Lineage for d4fvba_ (4fvb A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (20 species)
   not a true protein

7. Species Human enterovirus 71 [TaxId:39054] [189708] (7 PDB entries)

8. Domain d4fvba_: 4fvb A: [197381]
   automated match to d2hrva_
   complexed with zn; mutant

Details for d4fvba_

PDB Entry: 4fvb, 1.9 Å

PDB Description: Crystal structure of EV71 2A proteinase C110A mutant

PDB Compounds: (A:) 2A proteinase

SCOPe Domain Sequences for d4fvba_:

Sequence; same for both SEQRES and ATOM records:

>d4fvba_ b.47.1.0 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]}
sgaiyvgnfrvvnrhlathndwanlvwedssrdllvssttaqgcdtiarcncqtgvyycn
srrkhypvsfskpsliyveaseyyparyqshlmlaqghsepgdaggilrcqhgvvgivst
ggnglvgfadvrdllwld

Timeline for d4fvba_:

• d4fvba_ first appeared in SCOPe 2.02
  
• d4fvba_ appears in SCOPe 2.04
  
• d4fvba_ appears in SCOPe 2.06
  
• d4fvba_ appears in the current release, SCOPe 2.08