![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein CD4 V-set domains [48737] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48738] (33 PDB entries) |
![]() | Domain d1wiqa2: 1wiq A:179-291 [19737] Other proteins in same PDB: d1wiqa3, d1wiqa4, d1wiqb3, d1wiqb4 domains 1 and 3 |
PDB Entry: 1wiq (more details), 5 Å
SCOPe Domain Sequences for d1wiqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiqa2 b.1.1.1 (A:179-291) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} fqkassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsv krvtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvv
Timeline for d1wiqa2:
![]() Domains from other chains: (mouse over for more information) d1wiqb1, d1wiqb2, d1wiqb3, d1wiqb4 |