Lineage for d4aw8a_ (4aw8 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1132927Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1132928Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1133576Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
    bacterial metal-binding, lipocalin-like protein
  6. 1133584Protein automated matches [196992] (1 species)
    not a true protein
  7. 1133585Species Salmonella enterica [TaxId:440534] [196993] (2 PDB entries)
  8. 1133586Domain d4aw8a_: 4aw8 A: [197365]
    automated match to d1oeja_
    complexed with na, pg6, so4, zn

Details for d4aw8a_

PDB Entry: 4aw8 (more details), 2 Å

PDB Description: x-ray structure of zint from salmonella enterica in complex with zinc ion and peg
PDB Compounds: (A:) Metal-binding protein yodA

SCOPe Domain Sequences for d4aw8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aw8a_ b.60.1.4 (A:) automated matches {Salmonella enterica [TaxId: 440534]}
apmteveqkaaagvfddanvrdraltdwdgmwqsvypylvsgeldpvfrqkakkdpektf
edikayyrkgyvtnvetigiengviefhrdnnvasckynyagykiltyasgkkgvrylfe
ckdanskapkyvqfsdhiiaprksahfhifmgntsqqallqemenwptyypyqlkanevv
demlhh

SCOPe Domain Coordinates for d4aw8a_:

Click to download the PDB-style file with coordinates for d4aw8a_.
(The format of our PDB-style files is described here.)

Timeline for d4aw8a_: