Lineage for d4avse_ (4avs E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050921Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. 2051009Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 2051010Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)
  8. 2051020Domain d4avse_: 4avs E: [197364]
    automated match to d3kqra_
    complexed with ca, n7p, nag

Details for d4avse_

PDB Entry: 4avs (more details), 1.4 Å

PDB Description: structure of n-acetyl-l-proline bound to serum amyloid p component
PDB Compounds: (E:) serum amyloid p-component

SCOPe Domain Sequences for d4avse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4avse_ b.29.1.5 (E:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d4avse_:

Click to download the PDB-style file with coordinates for d4avse_.
(The format of our PDB-style files is described here.)

Timeline for d4avse_: