SCOPe 2.08: Domain d3ze7a_: 3ze7 A:

Lineage for d3ze7a_ (3ze7 A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (7 species)
   not a true protein

7. Species Desulfovibrio vulgaris [TaxId:882] [197352] (21 PDB entries)

8. Domain d3ze7a_: 3ze7 A: [197358]
   Other proteins in same PDB: d3ze7b_
   automated match to d1cc1s_
   complexed with fco, fe2, h2s, ni, sf4

Details for d3ze7a_

PDB Entry: 3ze7, 1.95 Å

PDB Description: 3d structure of the ni-fe-se hydrogenase from d. vulgaris hildenborough in the reduced state at 1.95 angstroms

PDB Compounds: (A:) periplasmic [nifese] hydrogenase, small subunit

SCOPe Domain Sequences for d3ze7a_:

Sequence; same for both SEQRES and ATOM records:

>d3ze7a_ e.19.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
rppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaiehmrkvae
kfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgtcaaygg
ipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkngleggl
aevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckgpmtmad
cferkwnggvnwcvqnavcigcvepdfpdgkspfyqa

Timeline for d3ze7a_:

• d3ze7a_ first appeared in SCOPe 2.02
  
• d3ze7a_ appears in SCOPe 2.07