Lineage for d3zeaa_ (3zea A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019034Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 3019069Protein automated matches [190110] (7 species)
    not a true protein
  7. 3019149Species Desulfovibrio vulgaris [TaxId:882] [197352] (21 PDB entries)
  8. 3019172Domain d3zeaa_: 3zea A: [197353]
    Other proteins in same PDB: d3zeab_
    automated match to d1cc1s_
    complexed with fco, fe2, h2s, ni, sf4

Details for d3zeaa_

PDB Entry: 3zea (more details), 1.82 Å

PDB Description: 3d structure of the nifese hydrogenase from d. vulgaris hildenborough in the reduced state at 1.82 angstroms
PDB Compounds: (A:) periplasmic [nifese] hydrogenase, small subunit

SCOPe Domain Sequences for d3zeaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zeaa_ e.19.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gerppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaiehmrkv
aekfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgtcaay
ggipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkngleg
glaevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckgpmtm
adcferkwnggvnwcvqnavcigcvepdfpdgkspfyqa

SCOPe Domain Coordinates for d3zeaa_:

Click to download the PDB-style file with coordinates for d3zeaa_.
(The format of our PDB-style files is described here.)

Timeline for d3zeaa_: