Lineage for d1wipb2 (1wip B:179-291)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739611Protein CD4 V-set domains [48737] (2 species)
  7. 2739612Species Human (Homo sapiens) [TaxId:9606] [48738] (33 PDB entries)
  8. 2739652Domain d1wipb2: 1wip B:179-291 [19735]
    Other proteins in same PDB: d1wipa3, d1wipa4, d1wipb3, d1wipb4
    domains 1 and 3

Details for d1wipb2

PDB Entry: 1wip (more details), 4 Å

PDB Description: structure of t-cell surface glycoprotein cd4, monoclinic crystal form
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d1wipb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wipb2 b.1.1.1 (B:179-291) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
fqkassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsv
krvtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvv

SCOPe Domain Coordinates for d1wipb2:

Click to download the PDB-style file with coordinates for d1wipb2.
(The format of our PDB-style files is described here.)

Timeline for d1wipb2: