Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) |
Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins) barrel, closed; n=5, S=10 |
Protein automated matches [190761] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [188650] (41 PDB entries) |
Domain d4kv6a_: 4kv6 A: [197342] automated match to d1joka_ complexed with ca, thp |
PDB Entry: 4kv6 (more details), 1.55 Å
SCOPe Domain Sequences for d4kv6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kv6a_ b.40.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllqkaeaqa kkeklniws
Timeline for d4kv6a_: