Lineage for d4kv6a_ (4kv6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2787873Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2787874Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2788157Protein automated matches [190761] (2 species)
    not a true protein
  7. 2788158Species Staphylococcus aureus [TaxId:1280] [188650] (41 PDB entries)
  8. 2788178Domain d4kv6a_: 4kv6 A: [197342]
    automated match to d1joka_
    complexed with ca, thp

Details for d4kv6a_

PDB Entry: 4kv6 (more details), 1.55 Å

PDB Description: crystal structure of staphylococcal nuclease variant delta+phs r126q at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d4kv6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kv6a_ b.40.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllqkaeaqa
kkeklniws

SCOPe Domain Coordinates for d4kv6a_:

Click to download the PDB-style file with coordinates for d4kv6a_.
(The format of our PDB-style files is described here.)

Timeline for d4kv6a_: