SCOPe 2.03: Domain d4kunb_: 4kun B:

Lineage for d4kunb_ (4kun B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:297246] [197273] (1 PDB entry)

8. Domain d4kunb_: 4kun B: [197340]
   automated match to d2qkea_

Details for d4kunb_

PDB Entry: 4kun, 1.95 Å

PDB Description: Crystal structure of Legionella pneumophila Lpp1115 / KaiB

PDB Compounds: (B:) Hypothetical protein Lpp1115

SCOPe Domain Sequences for d4kunb_:

Sequence; same for both SEQRES and ATOM records:

>d4kunb_ c.47.1.0 (B:) automated matches {Legionella pneumophila [TaxId: 297246]}
mtrtklklfvignsaiskraiinlqsicsdpkladlcdievvdlcknkgiaeqekilatp
ilikkeplperriigdlsdkqkvisalemd

Timeline for d4kunb_:

• d4kunb_ first appeared in SCOPe 2.02
  
• d4kunb_ appears in SCOPe 2.04
  
• d4kunb_ appears in the current release, SCOPe 2.08