Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein CD4 V-set domains [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries) |
Domain d1wipb1: 1wip B:1-97 [19734] Other proteins in same PDB: d1wipa3, d1wipa4, d1wipb3, d1wipb4 domains 1 and 3 |
PDB Entry: 1wip (more details), 4 Å
SCOPe Domain Sequences for d1wipb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wipb1 b.1.1.1 (B:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1wipb1:
View in 3D Domains from other chains: (mouse over for more information) d1wipa1, d1wipa2, d1wipa3, d1wipa4 |