Lineage for d4ktaa_ (4kta A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381453Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2381454Family b.40.1.1: Staphylococcal nuclease [50200] (2 protein domains)
    barrel, closed; n=5, S=10
  6. 2381725Protein automated matches [190761] (2 species)
    not a true protein
  7. 2381726Species Staphylococcus aureus [TaxId:1280] [188650] (41 PDB entries)
  8. 2381754Domain d4ktaa_: 4kta A: [197339]
    automated match to d3lx0a_
    complexed with ca, thp

Details for d4ktaa_

PDB Entry: 4kta (more details), 1.95 Å

PDB Description: crystal structure of staphylococcal nuclease variant delta+phs r105q at cryogenic temperatures
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d4ktaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ktaa_ b.40.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmvnealvqqglakvayvykgnntheqllrkaeaqa
kkeklniws

SCOPe Domain Coordinates for d4ktaa_:

Click to download the PDB-style file with coordinates for d4ktaa_.
(The format of our PDB-style files is described here.)

Timeline for d4ktaa_: