SCOPe 2.08: Domain d4jvua1: 4jvu A:225-337

Lineage for d4jvua1 (4jvu A:225-337)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4jvua1: 4jvu A:225-337 [197334]
   Other proteins in same PDB: d4jvua2
   automated match to d1g84a_

Details for d4jvua1

PDB Entry: 4jvu, 1.3 Å

PDB Description: IgM C2-domain from mouse

PDB Compounds: (A:) Ig mu chain C region membrane-bound form

SCOPe Domain Sequences for d4jvua1:

Sequence, based on SEQRES records:

>d4jvua1 b.1.1.0 (A:225-337) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ipavaemnpnvnvfvpprdgfsgpaprkskliceatnftpkpitvswlkdgklvesgftt
dpvtienkgstpqtykvistltiseidwlnlnvytcrvdhrgltflknvsstc

Sequence, based on observed residues (ATOM records):

>d4jvua1 b.1.1.0 (A:225-337) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ipavaemnpnvnvfvpprdgfsgpaprkskliceatnftpkpitvswlkdgklvesgftt
dpvtietpqtykvistltiseidwlnlnvytcrvdhrgltflknvsstc

Timeline for d4jvua1:

• d4jvua1 first appeared in SCOPe 2.02, called d4jvua_
  
• d4jvua1 appears in SCOPe 2.07