Lineage for d4is8a_ (4is8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009628Domain d4is8a_: 4is8 A: [197320]
    automated match to d1yuca_

Details for d4is8a_

PDB Entry: 4is8 (more details), 2.78 Å

PDB Description: Divergent sequence tunes ligand sensitivity in phospholipid-regulated hormone receptors
PDB Compounds: (A:) Nuclear receptor subfamily 5 group A member 2

SCOPe Domain Sequences for d4is8a_:

Sequence, based on SEQRES records: (download)

>d4is8a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsivew
arssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiash
tevafnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvna
alldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha

Sequence, based on observed residues (ATOM records): (download)

>d4is8a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siphlilellkcepdepqvqakimaylqqeqaklstfglmckmadqtlfsivewarssif
frelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiashtevafn
nlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvnaalldyt
mcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvplliemlha

SCOPe Domain Coordinates for d4is8a_:

Click to download the PDB-style file with coordinates for d4is8a_.
(The format of our PDB-style files is described here.)

Timeline for d4is8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4is8b_