Lineage for d1wipa1 (1wip A:1-97)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287527Protein CD4 V-set domains [48737] (2 species)
  7. 1287528Species Human (Homo sapiens) [TaxId:9606] [48738] (29 PDB entries)
  8. 1287561Domain d1wipa1: 1wip A:1-97 [19732]
    Other proteins in same PDB: d1wipa3, d1wipa4, d1wipb3, d1wipb4
    domains 1 and 3

Details for d1wipa1

PDB Entry: 1wip (more details), 4 Å

PDB Description: structure of t-cell surface glycoprotein cd4, monoclinic crystal form
PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d1wipa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wipa1 b.1.1.1 (A:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d1wipa1:

Click to download the PDB-style file with coordinates for d1wipa1.
(The format of our PDB-style files is described here.)

Timeline for d1wipa1: