Lineage for d4i5fb1 (4i5f B:2-249)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095774Species Ralstonia sp. [TaxId:517192] [197315] (6 PDB entries)
  8. 2095780Domain d4i5fb1: 4i5f B:2-249 [197317]
    Other proteins in same PDB: d4i5fa2, d4i5fb2, d4i5fc2, d4i5fd2, d4i5fe2, d4i5ff2, d4i5fg2, d4i5fh2
    automated match to d3vc7a_
    mutant

Details for d4i5fb1

PDB Entry: 4i5f (more details), 2.1 Å

PDB Description: crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s
PDB Compounds: (B:) Alclohol dehydrogenase/short-chain dehydrogenase

SCOPe Domain Sequences for d4i5fb1:

Sequence, based on SEQRES records: (download)

>d4i5fb1 c.2.1.0 (B:2-249) automated matches {Ralstonia sp. [TaxId: 517192]}
yrllnktavitgggsgiglatakrfvaegayvfivdvsrkeleqaaaeigrnvtavkadv
tkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvqk
alpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavspg
aidtpiienqvstqeeadelrakfaaatplgrvgrpeelaaavlflasddssyvagielf
vdggltqv

Sequence, based on observed residues (ATOM records): (download)

>d4i5fb1 c.2.1.0 (B:2-249) automated matches {Ralstonia sp. [TaxId: 517192]}
yrllnktavitgggsgiglatakrfvaegayvfivdvsrkeleqaaaeigrnvtavkadv
tkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvqk
alpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavspg
aidtpakfaaatplgrvgrpeelaaavlflasddssyvagielfvdggltqv

SCOPe Domain Coordinates for d4i5fb1:

Click to download the PDB-style file with coordinates for d4i5fb1.
(The format of our PDB-style files is described here.)

Timeline for d4i5fb1: