Lineage for d4gjqa_ (4gjq A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015647Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 2015648Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 2015649Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 protein domains)
  6. 2015650Protein Glycolipid transfer protein, GLTP [110006] (2 species)
  7. 2015653Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
    Uniprot Q9NZD2
  8. 2015670Domain d4gjqa_: 4gjq A: [197310]
    automated match to d2euka_
    complexed with cis, hex

Details for d4gjqa_

PDB Entry: 4gjq (more details), 2 Å

PDB Description: Crystal structure of human GLTP bound with 12:0 monosulfatide (orthorhombic form;two subunits in asymmetric unit)
PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d4gjqa_:

Sequence, based on SEQRES records: (download)

>d4gjqa_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvny
tatidviyemytqmnaelnykv

Sequence, based on observed residues (ATOM records): (download)

>d4gjqa_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalsvteeeclekirlflvnytati
dviyemytqmnaelnykv

SCOPe Domain Coordinates for d4gjqa_:

Click to download the PDB-style file with coordinates for d4gjqa_.
(The format of our PDB-style files is described here.)

Timeline for d4gjqa_: